PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g06330.1
Common NameLR48_Vigan09g239100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family VOZ
Protein Properties Length: 473aa    MW: 52390.3 Da    PI: 6.0317
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g06330.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ434.41.6e-1331984151217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdc+rp+qg +w+qdycssfha+lalneg+pg+tpvlrp+gi+lkd+llfaalsak++gk vgipecegaatakspwna+el
  Vang03g06330.1 198 PPPSAFLGPKCALWDCPRPVQGLDWCQDYCSSFHAALALNEGPPGMTPVLRPGGIGLKDNLLFAALSAKAHGKVVGIPECEGAATAKSPWNAPEL 292
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     fd+++legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp++ fewhlyeyei+ +da+alyrlelklv
  Vang03g06330.1 293 FDICVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNLFEWHLYEYEISMCDACALYRLELKLV 387
                     *********************************************************************************************** PP

             VOZ 191 dekksakgk.vskdsladlqkklgrlta 217
                     d+kks+k+k ++ ds+adlqk++g+l+a
  Vang03g06330.1 388 DGKKSSKAKiITGDSVADLQKHMGSLSA 415
                     *********5578************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MKKISKSSCK SASHRLFKDK ARNHVDDLQV MFLDLQFARK ESRTIDVALL EEQLHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSTDVYRL LQLCEEEDDA TSPLVAPKPE PNDQTMQPGA  120
RVIVQEGQHE QEFLLLKECK HSAVGVPNME ANNLDGPALE LHQFEFNKDL DHSFYAGTGF  180
CEEGGVPHIS SYLPSACPPP SAFLGPKCAL WDCPRPVQGL DWCQDYCSSF HAALALNEGP  240
PGMTPVLRPG GIGLKDNLLF AALSAKAHGK VVGIPECEGA ATAKSPWNAP ELFDICVLEG  300
ETIREWLFFD KPRRAFESGN RKQRSLPDYS GRGWHESRKQ VMNEFGGLKR SYYMDPQPLN  360
LFEWHLYEYE ISMCDACALY RLELKLVDGK KSSKAKIITG DSVADLQKHM GSLSAEFHSD  420
SNKRSAKGSR TKLGIGGGVY SASNRAALLN APYQYGLTAP YDFVVDNTSD YM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014516863.10.0PREDICTED: transcription factor VOZ1 isoform X1
RefseqXP_014516862.10.0PREDICTED: transcription factor VOZ1 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0S3S2R80.0A0A0S3S2R8_PHAAN; Uncharacterized protein
TrEMBLA0A0L9VFN50.0A0A0L9VFN5_PHAAN; Uncharacterized protein
STRINGGLYMA10G07940.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]